Veteran-owned business
[xoo_wsc_cart]

Veteran-owned business

Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.
LL-37 (5mg)

For research use only. Not for human consumption.

LL-37 (5mg)

LL-37 is a naturally occurring antimicrobial peptide extensively studied for its role in innate immune defense, antimicrobial activity, inflammation, cellular signaling, and tissue-repair research. Research Use Only — Not for Human Consumption.

Price:

$50.00

Select Quantity:

5 in stock

Peptide Compounds
Overview

Product Overview — LL-37

LL-37 is a 37-amino-acid antimicrobial peptide derived from the human cathelicidin precursor hCAP18. It is extensively studied as part of the innate immune system, with research focusing on its interactions with microbial membranes, immune-cell signaling, inflammatory pathways, and cellular responses involved in tissue repair.

LL-37 research has applications across immunology, microbiology, inflammation, wound biology, and host–pathogen interactions, making it a valuable peptide for laboratory and preclinical research.

Research Use Only — Not for Human Consumption.

Biochemical
Characteristics

Research Applications

Research Applications — LL-37

LL-37 is investigated across several areas of biomedical and cellular research, including:

  • Antimicrobial Research: Studies of interactions with bacterial, fungal, and other microbial membranes.
  • Innate Immunity: Investigation of how LL-37 participates in first-line immune defense and host–pathogen interactions.
  • Inflammation Research: Examination of LL-37’s interactions with inflammatory signaling pathways and immune-cell activity.
  • Wound-Healing Research: Research into cellular migration, proliferation, and signaling associated with tissue repair.
  • Cellular Signaling: Investigation of LL-37 interactions with cell-surface receptors and downstream signaling pathways.
  • Microbiome Research: Evaluation of peptide–microorganism interactions and potential effects on microbial communities.
  • Cancer Biology: Preclinical investigation of LL-37 interactions with tumor cells, proliferation pathways, and the tumor microenvironment.

Research Use Only — Not for Human Consumption.

Chemical Properties

Chemical Properties — LL-37

  • Peptide Name: LL-37 human cathelicidin
  • Sequence: [LL-37, 37 aa]
  • Length: 37 amino acids
  • Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
  • Molecular Weight: ~4,493 Da
  • Net Charge: Approximately +6 at physiological pH
  • Isoelectric Point (pI): Approximately 10.7
  • Structure: Predominantly amphipathic α-helical
  • Hydrophobicity: Amphipathic, with distinct hydrophobic and positively charged regions
  • Disulfide Bonds: None
  • Extinction Coefficient: Approximately 5,690 M⁻¹cm⁻¹ at 280 nm
  • Classification: Cationic antimicrobial peptide / cathelicidin

Research Use Only — Not for Human Consumption.

COA /HPLC / MS
3rd Party Testing

Tested by Freedom Diagnostics Testing @Freedom Diagnostics Testing – Reliable. Accountable. Accessible.

Storage

Product Storage — LL-37

  • Lyophilized Powder: Store refrigerated at 2–8°C for routine storage.
  • Long-Term Storage: For extended storage, keep at −20°C or below.
  • Protect From: Light, moisture, excessive heat, and repeated temperature fluctuations.
  • Handling: Allow the vial to reach room temperature before opening to minimize condensation.
  • After Reconstitution: Store refrigerated at 2–8°C and minimize repeated freeze–thaw cycles.
  • Sterility: Reconstitution should be performed using appropriate aseptic laboratory techniques.

For Research Use Only — Not for Human Consumption.

Your cart is currently empty.

Return to shop

Categories , , ,

Command Center is a leading provider of USA manufactured, research peptides.

Quick Links
Legal

Copyright 2026 © Command Center All Rights Reserved

Instagram X-twitter Linkedin-in Facebook-f
0